Lineage for d1s0la_ (1s0l A:)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.42: beta-Trefoil [50352] (6 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (5 proteins) Protein Interleukin-1beta [50363] (2 species) Species Human (Homo sapiens) [TaxId:9606] [50364] (15 PDB entries) 
Domain d1s0la_: 1s0l A: [98289]
mutant
Details for d1s0la_
PDB Entry: 1s0l (more details), 2.34 Å
PDB Description: interleukin 1 beta mutant f42w
SCOP Domain Sequences for d1s0la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0la_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens)}
apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvwsmsfvqgeesndkipval
glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
yistsqaenmpvflggtkggqditdftmqfvss
SCOP Domain Coordinates for d1s0la_:
Click to download the PDB-style file with coordinates for d1s0la_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s0la_:
- d1s0la_ is new in SCOP 1.67
- d1s0la_ appears in SCOP 1.69
- d1s0la_ appears in the current release, SCOPe 2.08
View in 3D