Class b: All beta proteins [48724] (141 folds) |
Fold b.42: beta-Trefoil [50352] (6 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (2 families) |
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (5 proteins) |
Protein Interleukin-1beta [50363] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50364] (15 PDB entries) |
Domain d1s0la_: 1s0l A: [98289] mutant |
PDB Entry: 1s0l (more details), 2.34 Å
SCOP Domain Sequences for d1s0la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0la_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens)} apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvwsmsfvqgeesndkipval glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw yistsqaenmpvflggtkggqditdftmqfvss
Timeline for d1s0la_: