![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.4: STI-like [50386] (3 families) ![]() |
![]() | Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins) overall fold is very similar to that of the STI family automatically mapped to Pfam PF07951 |
![]() | Protein Botulinum neurotoxin [50402] (2 species) |
![]() | Species Clostridium botulinum, serotype B [TaxId:1491] [50404] (14 PDB entries) |
![]() | Domain d1s0ga2: 1s0g A:1080-1290 [98286] Other proteins in same PDB: d1s0ga1, d1s0ga3, d1s0ga4 |
PDB Entry: 1s0g (more details), 2.6 Å
SCOPe Domain Sequences for d1s0ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0ga2 b.42.4.2 (A:1080-1290) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} seylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdly igekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisd sdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcis kwylkevkrkpynlklgcnwqfipkdegwte
Timeline for d1s0ga2: