Lineage for d1s0fa4 (1s0f A:534-861)

  1. Root: SCOP 1.69
  2. 525081Class h: Coiled coil proteins [57942] (6 folds)
  3. 526142Fold h.4: Antiparallel coiled-coil [58086] (16 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 526151Superfamily h.4.2: Clostridium neurotoxins, "coiled-coil" domain [58091] (1 family) (S)
  5. 526152Family h.4.2.1: Clostridium neurotoxins, "coiled-coil" domain [58092] (1 protein)
  6. 526153Protein Botulinum neurotoxin [58093] (2 species)
  7. 526156Species Clostridium botulinum, serotype B [TaxId:1491] [58095] (13 PDB entries)
  8. 526165Domain d1s0fa4: 1s0f A:534-861 [98284]
    Other proteins in same PDB: d1s0fa1, d1s0fa2, d1s0fa3

Details for d1s0fa4

PDB Entry: 1s0f (more details), 2.3 Å

PDB Description: Crystal structure of botulinum neurotoxin type B at pH 7.0

SCOP Domain Sequences for d1s0fa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0fa4 h.4.2.1 (A:534-861) Botulinum neurotoxin {Clostridium botulinum, serotype B}
ntifqylysqtfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwv
kqivndfvieanksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillef
ipellipvvgafllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfyt
ikegmykalnyqaqaleeiikyryniysekeksninidfndinsklneginqaidninnf
ingcsvsylmkkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylkt
impfdlsiytndtiliemfnkynseiln

SCOP Domain Coordinates for d1s0fa4:

Click to download the PDB-style file with coordinates for d1s0fa4.
(The format of our PDB-style files is described here.)

Timeline for d1s0fa4: