Lineage for d1s0ea3 (1s0e A:1-533)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570620Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 2570621Protein Botulinum neurotoxin [55513] (4 species)
  7. 2570660Species Clostridium botulinum, serotype B [TaxId:1491] [55515] (17 PDB entries)
  8. 2570662Domain d1s0ea3: 1s0e A:1-533 [98279]
    Other proteins in same PDB: d1s0ea1, d1s0ea2, d1s0ea4
    complexed with ca, zn

Details for d1s0ea3

PDB Entry: 1s0e (more details), 1.9 Å

PDB Description: Crystal structure of botulinum neurotoxin type B at pH 6.0
PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d1s0ea3:

Sequence, based on SEQRES records: (download)

>d1s0ea3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeiskehlavykiqmcksvkapgicidvdnedlffiadknsfsddlsknerieyntqsny
iendfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftde

Sequence, based on observed residues (ATOM records): (download)

>d1s0ea3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeiskehlavykiqmcksvgicidvdnedlffiadknsfsddlsknerieyntqsnyien
dfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftde

SCOPe Domain Coordinates for d1s0ea3:

Click to download the PDB-style file with coordinates for d1s0ea3.
(The format of our PDB-style files is described here.)

Timeline for d1s0ea3: