Class b: All beta proteins [48724] (141 folds) |
Fold b.42: beta-Trefoil [50352] (6 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (2 families) |
Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins) overall fold is very similar to that of the STI family |
Protein Botulinum neurotoxin [50402] (2 species) |
Species Clostridium botulinum, serotype B [TaxId:1491] [50404] (13 PDB entries) |
Domain d1s0ca2: 1s0c A:1080-1290 [98270] Other proteins in same PDB: d1s0ca1, d1s0ca3, d1s0ca4 complexed with ca, zn |
PDB Entry: 1s0c (more details), 2.2 Å
SCOP Domain Sequences for d1s0ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0ca2 b.42.4.2 (A:1080-1290) Botulinum neurotoxin {Clostridium botulinum, serotype B} seylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdly igekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisd sdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcis kwylkevkrkpynlklgcnwqfipkdegwte
Timeline for d1s0ca2: