Lineage for d1s0ca1 (1s0c A:862-1079)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371737Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (2 proteins)
  6. 371738Protein Botulinum neurotoxin [49959] (2 species)
  7. 371741Species Clostridium botulinum, serotype B [TaxId:1491] [49961] (13 PDB entries)
  8. 371747Domain d1s0ca1: 1s0c A:862-1079 [98269]
    Other proteins in same PDB: d1s0ca2, d1s0ca3, d1s0ca4
    complexed with ca, zn

Details for d1s0ca1

PDB Entry: 1s0c (more details), 2.2 Å

PDB Description: Crystal structure of botulinum neurotoxin type B at pH 5.0

SCOP Domain Sequences for d1s0ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0ca1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B}
niilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqnqniifnsv
fldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlidingkt
ksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdireviangeiif
kldgdidrtqfiwmkyfsifntelsqsnieerykiqsy

SCOP Domain Coordinates for d1s0ca1:

Click to download the PDB-style file with coordinates for d1s0ca1.
(The format of our PDB-style files is described here.)

Timeline for d1s0ca1: