Lineage for d1s0ba3 (1s0b A:1-533)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607530Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 607531Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 607673Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (1 protein)
  6. 607674Protein Botulinum neurotoxin [55513] (3 species)
  7. 607682Species Clostridium botulinum, serotype B [TaxId:1491] [55515] (15 PDB entries)
  8. 607686Domain d1s0ba3: 1s0b A:1-533 [98267]
    Other proteins in same PDB: d1s0ba1, d1s0ba2, d1s0ba4
    complexed with ca

Details for d1s0ba3

PDB Entry: 1s0b (more details), 2 Å

PDB Description: Crystal structure of botulinum neurotoxin type B at pH 4.0

SCOP Domain Sequences for d1s0ba3:

Sequence, based on SEQRES records: (download)

>d1s0ba3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeiskehlavykiqmcksvkapgicidvdnedlffiadknsfsddlsknerieyntqsny
iendfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftde

Sequence, based on observed residues (ATOM records): (download)

>d1s0ba3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeiskehlavykiqmcksvgicidvdnedlffiadknsfsddlsknerieyntqsnyien
dfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftde

SCOP Domain Coordinates for d1s0ba3:

Click to download the PDB-style file with coordinates for d1s0ba3.
(The format of our PDB-style files is described here.)

Timeline for d1s0ba3: