Lineage for d1s0ba1 (1s0b A:862-1079)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 460436Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (2 proteins)
  6. 460437Protein Botulinum neurotoxin [49959] (2 species)
  7. 460440Species Clostridium botulinum, serotype B [TaxId:1491] [49961] (13 PDB entries)
  8. 460443Domain d1s0ba1: 1s0b A:862-1079 [98265]
    Other proteins in same PDB: d1s0ba2, d1s0ba3, d1s0ba4

Details for d1s0ba1

PDB Entry: 1s0b (more details), 2 Å

PDB Description: Crystal structure of botulinum neurotoxin type B at pH 4.0

SCOP Domain Sequences for d1s0ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0ba1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B}
niilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqnqniifnsv
fldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlidingkt
ksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdireviangeiif
kldgdidrtqfiwmkyfsifntelsqsnieerykiqsy

SCOP Domain Coordinates for d1s0ba1:

Click to download the PDB-style file with coordinates for d1s0ba1.
(The format of our PDB-style files is described here.)

Timeline for d1s0ba1: