Lineage for d1s07a_ (1s07 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131773Protein Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA [53438] (2 species)
    synonym: 7,8-diaminopelargonic acid synthase
  7. 2131779Species Escherichia coli [TaxId:562] [53439] (11 PDB entries)
  8. 2131798Domain d1s07a_: 1s07 A: [98257]
    complexed with ipa, na, plp; mutant

Details for d1s07a_

PDB Entry: 1s07 (more details), 2.42 Å

PDB Description: Crystal Structure of the R253A Mutant of 7,8-Diaminopelargonic Acid Synthase
PDB Compounds: (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

SCOPe Domain Sequences for d1s07a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s07a_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]}
mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
lliadeiatgfgatgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
vqdetffcq

SCOPe Domain Coordinates for d1s07a_:

Click to download the PDB-style file with coordinates for d1s07a_.
(The format of our PDB-style files is described here.)

Timeline for d1s07a_: