Lineage for d1s06a_ (1s06 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399758Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 399759Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 400166Family c.67.1.4: GABA-aminotransferase-like [53417] (13 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 400199Protein Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA [53438] (1 species)
    synonym: 7,8-diaminopelargonic acid synthase
  7. 400200Species Escherichia coli [TaxId:562] [53439] (11 PDB entries)
  8. 400213Domain d1s06a_: 1s06 A: [98255]

Details for d1s06a_

PDB Entry: 1s06 (more details), 2.2 Å

PDB Description: crystal structure of the r253k mutant of 7,8-diaminopelargonic acid synthase

SCOP Domain Sequences for d1s06a_:

Sequence, based on SEQRES records: (download)

>d1s06a_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli}
mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
lliadeiatgfgktgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
vqdetffcq

Sequence, based on observed residues (ATOM records): (download)

>d1s06a_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli}
mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
rmgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregil
liadeiatgfgktgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisngea
gcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvrv
lgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnrav
qdetffcq

SCOP Domain Coordinates for d1s06a_:

Click to download the PDB-style file with coordinates for d1s06a_.
(The format of our PDB-style files is described here.)

Timeline for d1s06a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1s06b_