SCOPe 2.06: Domain d1s05a_: 1s05 A:

Lineage for d1s05a_ (1s05 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
   automatically mapped to Pfam PF01322

6. Protein Cytochrome c-556 [101109] (1 species)

7. Species Rhodopseudomonas palustris [TaxId:1076] [101110] (1 PDB entry)

8. Domain d1s05a_: 1s05 A: [98254]
   complexed with hem

Details for d1s05a_

PDB Entry: 1s05

PDB Description: nmr-validated structural model for oxidized r.palustris cytochrome c556

PDB Compounds: (A:) Cytochrome c-556

SCOPe Domain Sequences for d1s05a_:

Sequence; same for both SEQRES and ATOM records:

>d1s05a_ a.24.3.2 (A:) Cytochrome c-556 {Rhodopseudomonas palustris [TaxId: 1076]}
qqdlvdktqklmkdngrnmmvlgaiakgekpydqaavdaalkqfdetakdlpklfpdsvk
glkpfdskyssspkiwaerakfdteiadfakavdgakgkikdvdtlkaamqpigkacgnc
henfrdkeg

Timeline for d1s05a_:

• d1s05a_ first appeared in SCOP 1.67
  
• d1s05a_ appears in SCOPe 2.05
  
• d1s05a_ appears in SCOPe 2.07
  
• d1s05a_ appears in the current release, SCOPe 2.08