![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.3: Cytochromes [47175] (3 families) ![]() Heme-containing proteins |
![]() | Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins) automatically mapped to Pfam PF01322 |
![]() | Protein Cytochrome c-556 [101109] (1 species) |
![]() | Species Rhodopseudomonas palustris [TaxId:1076] [101110] (1 PDB entry) |
![]() | Domain d1s05a_: 1s05 A: [98254] complexed with hec |
PDB Entry: 1s05 (more details)
SCOPe Domain Sequences for d1s05a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s05a_ a.24.3.2 (A:) Cytochrome c-556 {Rhodopseudomonas palustris [TaxId: 1076]} qqdlvdktqklmkdngrnmmvlgaiakgekpydqaavdaalkqfdetakdlpklfpdsvk glkpfdskyssspkiwaerakfdteiadfakavdgakgkikdvdtlkaamqpigkacgnc henfrdkeg
Timeline for d1s05a_: