Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)
Search SCOP (example):

Lineage for d1s00r_ (1s00 R:)

  1. Root: SCOP 1.75
  2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 protein domains)
    L and M are probably related to each other
  6. Protein L (light) subunit [81477] (3 species)
  7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (67 PDB entries)
    Uniprot P02954
  8. Domain d1s00r_: 1s00 R: [98250]
    Other proteins in same PDB: d1s00h1, d1s00h2, d1s00m_, d1s00s_, d1s00t1, d1s00t2
    complexed with bcl, bph, fe2, lda, spo, u10; mutant

Details for d1s00r_

PDB Entry: 1s00 (more details)
PDB Description: photosynthetic reaction center double mutant from rhodobacte sphaeroides with asp l213 replaced with asn and arg m233 re with cys in the charge-separated d+qaqb- state
PDB Compounds: (R:) reaction center protein l chain

SCOP Domain Sequences for d1s00r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s00r_ f.26.1.1 (R:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhentffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOP Domain Coordinates for d1s00r_:

Click to download the PDB-style file with coordinates for d1s00r_.
(The format of our PDB-style files is described here.)

Timeline for d1s00r_:

d1s00r_ appears in SCOP 1.73
d1s00r_ appears in SCOP 1.75A


d1s00r_
(click for larger image)


d1s00r_ in context of chain



d1s00r_ in context of PDB
Domains from other chains:
d1s00h1, d1s00h2, d1s00l_, d1s00m_, d1s00s_, d1s00t1, d1s00t2

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu