Lineage for d1rztm1 (1rzt M:249-328)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356779Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 356901Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 356902Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 357011Protein DNA polymerase lambda [101251] (1 species)
  7. 357012Species Human (Homo sapiens) [TaxId:9606] [101252] (2 PDB entries)
  8. 357016Domain d1rztm1: 1rzt M:249-328 [98233]
    Other proteins in same PDB: d1rzta2, d1rzta3, d1rzte2, d1rzte3, d1rzti2, d1rzti3, d1rztm2, d1rztm3
    complexed with edo, na; mutant

Details for d1rztm1

PDB Entry: 1rzt (more details), 2.1 Å

PDB Description: crystal structure of dna polymerase lambda complexed with a two nucleotide gap dna molecule

SCOP Domain Sequences for d1rztm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rztm1 a.60.6.1 (M:249-328) DNA polymerase lambda {Human (Homo sapiens)}
atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
maekiieilesghlrkldhi

SCOP Domain Coordinates for d1rztm1:

Click to download the PDB-style file with coordinates for d1rztm1.
(The format of our PDB-style files is described here.)

Timeline for d1rztm1: