Lineage for d1rzte2 (1rzt E:329-385)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1090417Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1091050Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1091051Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 1091183Protein DNA polymerase lambda [101253] (1 species)
  7. 1091184Species Human (Homo sapiens) [TaxId:9606] [101254] (16 PDB entries)
  8. 1091195Domain d1rzte2: 1rzt E:329-385 [98228]
    Other proteins in same PDB: d1rzta1, d1rzta3, d1rzte1, d1rzte3, d1rzti1, d1rzti3, d1rztm1, d1rztm3
    protein/DNA complex; complexed with edo, na

Details for d1rzte2

PDB Entry: 1rzt (more details), 2.1 Å

PDB Description: crystal structure of dna polymerase lambda complexed with a two nucleotide gap dna molecule
PDB Compounds: (E:) DNA polymerase lambda

SCOPe Domain Sequences for d1rzte2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzte2 a.60.12.1 (E:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOPe Domain Coordinates for d1rzte2:

Click to download the PDB-style file with coordinates for d1rzte2.
(The format of our PDB-style files is described here.)

Timeline for d1rzte2: