Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) contains one classic and one pseudo HhH motifs |
Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain automatically mapped to Pfam PF10391 |
Protein DNA polymerase lambda [101253] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101254] (27 PDB entries) |
Domain d1rzte2: 1rzt E:329-385 [98228] Other proteins in same PDB: d1rzta1, d1rzta3, d1rzte1, d1rzte3, d1rzti1, d1rzti3, d1rztm1, d1rztm3 protein/DNA complex; complexed with edo, na |
PDB Entry: 1rzt (more details), 2.1 Å
SCOPe Domain Sequences for d1rzte2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzte2 a.60.12.1 (E:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle
Timeline for d1rzte2: