| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
| Protein DNA polymerase lambda [101251] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [101252] (2 PDB entries) |
| Domain d1rzte1: 1rzt E:250-328 [98227] Other proteins in same PDB: d1rzta2, d1rzta3, d1rzte2, d1rzte3, d1rzti2, d1rzti3, d1rztm2, d1rztm3 |
PDB Entry: 1rzt (more details), 2.1 Å
SCOP Domain Sequences for d1rzte1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzte1 a.60.6.1 (E:250-328) DNA polymerase lambda {Human (Homo sapiens)}
tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
aekiieilesghlrkldhi
Timeline for d1rzte1: