Lineage for d1rzta1 (1rzt A:249-328)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1090417Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1090716Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 1090717Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 1090841Protein DNA polymerase lambda [101251] (1 species)
  7. 1090842Species Human (Homo sapiens) [TaxId:9606] [101252] (17 PDB entries)
  8. 1090852Domain d1rzta1: 1rzt A:249-328 [98224]
    Other proteins in same PDB: d1rzta2, d1rzta3, d1rzte2, d1rzte3, d1rzti2, d1rzti3, d1rztm2, d1rztm3
    protein/DNA complex; complexed with edo, na

Details for d1rzta1

PDB Entry: 1rzt (more details), 2.1 Å

PDB Description: crystal structure of dna polymerase lambda complexed with a two nucleotide gap dna molecule
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d1rzta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzta1 a.60.6.1 (A:249-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
maekiieilesghlrkldhi

SCOPe Domain Coordinates for d1rzta1:

Click to download the PDB-style file with coordinates for d1rzta1.
(The format of our PDB-style files is described here.)

Timeline for d1rzta1: