Lineage for d1rzqc2 (1rzq C:167-335)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 791546Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 791669Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 791670Species Achromobacter cycloclastes [TaxId:223] [49552] (10 PDB entries)
  8. 791692Domain d1rzqc2: 1rzq C:167-335 [98223]
    complexed with acy, cu, so4

Details for d1rzqc2

PDB Entry: 1rzq (more details), 2.2 Å

PDB Description: Crystal Structure of C-Terminal Despentapeptide Nitrite Reductase from Achromobacter Cycloclastes at pH5.0
PDB Compounds: (C:) Copper-containing nitrite reductase

SCOP Domain Sequences for d1rzqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzqc2 b.6.1.3 (C:167-335) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvv

SCOP Domain Coordinates for d1rzqc2:

Click to download the PDB-style file with coordinates for d1rzqc2.
(The format of our PDB-style files is described here.)

Timeline for d1rzqc2: