Lineage for d1rzqa2 (1rzq A:167-335)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 369112Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 369113Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 369433Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins)
  6. 369511Protein Nitrite reductase, NIR [49551] (4 species)
    consists of two domains of this fold
  7. 369512Species Achromobacter cycloclastes [TaxId:223] [49552] (10 PDB entries)
  8. 369532Domain d1rzqa2: 1rzq A:167-335 [98219]

Details for d1rzqa2

PDB Entry: 1rzq (more details), 2.2 Å

PDB Description: Crystal Structure of C-Terminal Despentapeptide Nitrite Reductase from Achromobacter Cycloclastes at pH5.0

SCOP Domain Sequences for d1rzqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzqa2 b.6.1.3 (A:167-335) Nitrite reductase, NIR {Achromobacter cycloclastes}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvv

SCOP Domain Coordinates for d1rzqa2:

Click to download the PDB-style file with coordinates for d1rzqa2.
(The format of our PDB-style files is described here.)

Timeline for d1rzqa2: