Lineage for d1rzqa1 (1rzq A:8-166)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1302646Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1302647Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1303271Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1303430Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 1303431Species Achromobacter cycloclastes [TaxId:223] [49552] (15 PDB entries)
  8. 1303460Domain d1rzqa1: 1rzq A:8-166 [98218]
    complexed with acy, cu, so4

Details for d1rzqa1

PDB Entry: 1rzq (more details), 2.2 Å

PDB Description: Crystal Structure of C-Terminal Despentapeptide Nitrite Reductase from Achromobacter Cycloclastes at pH5.0
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1rzqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzqa1 b.6.1.3 (A:8-166) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

SCOPe Domain Coordinates for d1rzqa1:

Click to download the PDB-style file with coordinates for d1rzqa1.
(The format of our PDB-style files is described here.)

Timeline for d1rzqa1: