SCOPe 2.04: Domain d1rzpc2: 1rzp C:167-335

Lineage for d1rzpc2 (1rzp C:167-335)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Achromobacter cycloclastes [TaxId:223] [49552] (15 PDB entries)

8. Domain d1rzpc2: 1rzp C:167-335 [98217]
   complexed with cu, mes, so4

Details for d1rzpc2

PDB Entry: 1rzp, 1.9 Å

PDB Description: Crystal Structure of C-Terminal Despentapeptide Nitrite Reductase from Achromobacter Cycloclastes at pH6.2

PDB Compounds: (C:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1rzpc2:

Sequence; same for both SEQRES and ATOM records:

>d1rzpc2 b.6.1.3 (C:167-335) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvv

Timeline for d1rzpc2:

• d1rzpc2 first appeared in SCOP 1.67
  
• d1rzpc2 appears in SCOPe 2.03
  
• d1rzpc2 appears in SCOPe 2.05
  
• d1rzpc2 appears in the current release, SCOPe 2.08