SCOPe 2.02: Domain d1rzpc1: 1rzp C:4-166

Lineage for d1rzpc1 (1rzp C:4-166)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Achromobacter cycloclastes [TaxId:223] [49552] (14 PDB entries)

8. Domain d1rzpc1: 1rzp C:4-166 [98216]
   complexed with cu, mes, so4

Details for d1rzpc1

PDB Entry: 1rzp, 1.9 Å

PDB Description: Crystal Structure of C-Terminal Despentapeptide Nitrite Reductase from Achromobacter Cycloclastes at pH6.2

PDB Compounds: (C:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1rzpc1:

Sequence; same for both SEQRES and ATOM records:

>d1rzpc1 b.6.1.3 (C:4-166) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
aapvdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamt
fngsvpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlr
fkatkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

Timeline for d1rzpc1:

• d1rzpc1 first appeared in SCOP 1.67
  
• d1rzpc1 appears in SCOPe 2.01
  
• d1rzpc1 appears in SCOPe 2.03
  
• d1rzpc1 appears in the current release, SCOPe 2.08