Lineage for d1rzpc1 (1rzp C:4-166)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771729Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species)
  7. 2771730Species Achromobacter cycloclastes [TaxId:223] [419324] (51 PDB entries)
  8. 2771758Domain d1rzpc1: 1rzp C:4-166 [98216]
    Other proteins in same PDB: d1rzpa2, d1rzpb2, d1rzpc2
    complexed with cu, mes, so4

Details for d1rzpc1

PDB Entry: 1rzp (more details), 1.9 Å

PDB Description: Crystal Structure of C-Terminal Despentapeptide Nitrite Reductase from Achromobacter Cycloclastes at pH6.2
PDB Compounds: (C:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1rzpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzpc1 b.6.1.3 (C:4-166) Nitrite reductase, NIR, N-terminal domain {Achromobacter cycloclastes [TaxId: 223]}
aapvdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamt
fngsvpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlr
fkatkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

SCOPe Domain Coordinates for d1rzpc1:

Click to download the PDB-style file with coordinates for d1rzpc1.
(The format of our PDB-style files is described here.)

Timeline for d1rzpc1: