Lineage for d1rzpb2 (1rzp B:167-335)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771509Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)
  7. 2771510Species Achromobacter cycloclastes [TaxId:223] [419325] (60 PDB entries)
  8. 2771537Domain d1rzpb2: 1rzp B:167-335 [98215]
    Other proteins in same PDB: d1rzpa1, d1rzpb1, d1rzpc1
    complexed with cu, mes, so4
    has additional insertions and/or extensions that are not grouped together

Details for d1rzpb2

PDB Entry: 1rzp (more details), 1.9 Å

PDB Description: Crystal Structure of C-Terminal Despentapeptide Nitrite Reductase from Achromobacter Cycloclastes at pH6.2
PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1rzpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzpb2 b.6.1.3 (B:167-335) Nitrite reductase, NIR, C-terminal domain {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvv

SCOPe Domain Coordinates for d1rzpb2:

Click to download the PDB-style file with coordinates for d1rzpb2.
(The format of our PDB-style files is described here.)

Timeline for d1rzpb2: