Lineage for d1rzpa2 (1rzp A:167-335)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 791546Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 791669Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 791670Species Achromobacter cycloclastes [TaxId:223] [49552] (10 PDB entries)
  8. 791676Domain d1rzpa2: 1rzp A:167-335 [98213]

Details for d1rzpa2

PDB Entry: 1rzp (more details), 1.9 Å

PDB Description: Crystal Structure of C-Terminal Despentapeptide Nitrite Reductase from Achromobacter Cycloclastes at pH6.2
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOP Domain Sequences for d1rzpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzpa2 b.6.1.3 (A:167-335) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvv

SCOP Domain Coordinates for d1rzpa2:

Click to download the PDB-style file with coordinates for d1rzpa2.
(The format of our PDB-style files is described here.)

Timeline for d1rzpa2: