![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88569] (132 PDB entries) SQ NA # humanized antibody Uniprot P01834 # KAC_HUMAN Ig kappa chain C region SQ P01834 # KAC_HUMAN Ig kappa chain C region. SQ NA # engineered antibody including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
![]() | Domain d1rzkl2: 1rzk L:110-212 [98211] Other proteins in same PDB: d1rzkc1, d1rzkc2, d1rzkg_, d1rzkh1, d1rzkh2, d1rzkl1 part of anti HIV-1 gp120-reactive Fab 17B complexed with nag; mutant |
PDB Entry: 1rzk (more details), 2.9 Å
SCOP Domain Sequences for d1rzkl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzkl2 b.1.1.2 (L:110-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} vaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk dstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d1rzkl2: