SCOP 1.67: Domain d1rzkh2: 1rzk H:114-214

Lineage for d1rzkh2 (1rzk H:114-214)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1rzkh2: 1rzk H:114-214 [98209]
   Other proteins in same PDB: d1rzkc1, d1rzkc2, d1rzkg_, d1rzkh1, d1rzkl1, d1rzkl2
   part of anti HIV-1 gp120-reactive Fab 17B
   complexed with nag; mutant

Details for d1rzkh2

PDB Entry: 1rzk, 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

PDB Compounds: (H:)

SCOP Domain Sequences for d1rzkh2:

Sequence; same for both SEQRES and ATOM records:

>d1rzkh2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1rzkh2:

• d1rzkh2 appears in SCOP 1.69
  
• d1rzkh2 appears in the current release, SCOPe 2.07