Lineage for d1rzkc1 (1rzk C:1-97)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510334Protein CD4 V-set domains [48737] (2 species)
  7. 1510335Species Human (Homo sapiens) [TaxId:9606] [48738] (31 PDB entries)
  8. 1510357Domain d1rzkc1: 1rzk C:1-97 [98205]
    Other proteins in same PDB: d1rzkc2, d1rzkg_, d1rzkh1, d1rzkh2, d1rzkl1, d1rzkl2
    domain 1
    complexed with nag, ndg

Details for d1rzkc1

PDB Entry: 1rzk (more details), 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d1rzkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzkc1 b.1.1.1 (C:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOPe Domain Coordinates for d1rzkc1:

Click to download the PDB-style file with coordinates for d1rzkc1.
(The format of our PDB-style files is described here.)

Timeline for d1rzkc1: