SCOP 1.73: Domain d1rzkc1: 1rzk C:1-97

Lineage for d1rzkc1 (1rzk C:1-97)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein CD4 V-set domains [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (25 PDB entries)

8. Domain d1rzkc1: 1rzk C:1-97 [98205]
   Other proteins in same PDB: d1rzkc2, d1rzkg_, d1rzkh1, d1rzkh2, d1rzkl1, d1rzkl2
   domain 1
   complexed with nag; mutant

Details for d1rzkc1

PDB Entry: 1rzk, 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOP Domain Sequences for d1rzkc1:

Sequence; same for both SEQRES and ATOM records:

>d1rzkc1 b.1.1.1 (C:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d1rzkc1:

• d1rzkc1 first appeared in SCOP 1.67
  
• d1rzkc1 appears in SCOP 1.71
  
• d1rzkc1 appears in SCOP 1.75
  
• d1rzkc1 appears in the current release, SCOPe 2.08