SCOP 1.71: Domain d1rzjl2: 1rzj L:110-212

Lineage for d1rzjl2 (1rzj L:110-212)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (100 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1rzjl2: 1rzj L:110-212 [98204]
   Other proteins in same PDB: d1rzjc1, d1rzjc2, d1rzjg_, d1rzjh1, d1rzjh2, d1rzjl1
   part of anti HIV-1 gp120-reactive Fab 17B
   complexed with fuc, ioh, nag; mutant

Details for d1rzjl2

PDB Entry: 1rzj, 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1rzjl2:

Sequence; same for both SEQRES and ATOM records:

>d1rzjl2 b.1.1.2 (L:110-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
vaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d1rzjl2:

• d1rzjl2 first appeared in SCOP 1.67
  
• d1rzjl2 appears in SCOP 1.69
  
• d1rzjl2 appears in SCOP 1.73
  
• d1rzjl2 appears in the current release, SCOPe 2.07