SCOP 1.67: Domain d1rzjh2: 1rzj H:114-214

Lineage for d1rzjh2 (1rzj H:114-214)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1rzjh2: 1rzj H:114-214 [98202]
   Other proteins in same PDB: d1rzjc1, d1rzjc2, d1rzjg_, d1rzjh1, d1rzjl1, d1rzjl2
   part of anti HIV-1 gp120-reactive Fab 17B
   complexed with fuc, ioh, nag; mutant

Details for d1rzjh2

PDB Entry: 1rzj, 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1rzjh2:

Sequence; same for both SEQRES and ATOM records:

>d1rzjh2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1rzjh2:

• d1rzjh2 is new in SCOP 1.67
  
• d1rzjh2 appears in SCOP 1.69
  
• d1rzjh2 appears in the current release, SCOPe 2.08