Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.3: C2 set domains [49142] (8 proteins) |
Protein CD4 C2-set domains [49149] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49150] (26 PDB entries) |
Domain d1rzjc2: 1rzj C:98-181 [98199] Other proteins in same PDB: d1rzjc1, d1rzjg_, d1rzjh1, d1rzjh2, d1rzjl1, d1rzjl2 domain 2 complexed with ipa, nag, ndg |
PDB Entry: 1rzj (more details), 2.2 Å
SCOPe Domain Sequences for d1rzjc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzjc2 b.1.1.3 (C:98-181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvlafqk
Timeline for d1rzjc2: