SCOP 1.73: Domain d1rzii2: 1rzi I:108-213

Lineage for d1rzii2 (1rzi I:108-213)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1rzii2: 1rzi I:108-213 [98183]
   Other proteins in same PDB: d1rzia1, d1rzib1, d1rzib2, d1rzic1, d1rzid1, d1rzid2, d1rzie1, d1rzif1, d1rzif2, d1rzig1, d1rzih1, d1rzih2, d1rzii1, d1rzij1, d1rzij2, d1rzik1, d1rzil1, d1rzil2, d1rzim1, d1rzin1, d1rzin2, d1rzio1, d1rzip1, d1rzip2

Details for d1rzii2

PDB Entry: 1rzi, 2.9 Å

PDB Description: Crystal structure of human anti-HIV-1 gp120-reactive antibody 47e fab

PDB Compounds: (I:) Fab 47e light chain

SCOP Domain Sequences for d1rzii2:

Sequence; same for both SEQRES and ATOM records:

>d1rzii2 b.1.1.2 (I:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d1rzii2:

• d1rzii2 first appeared in SCOP 1.67
  
• d1rzii2 appears in SCOP 1.71
  
• d1rzii2 appears in SCOP 1.75
  
• d1rzii2 appears in the current release, SCOPe 2.08