Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1rzii2: 1rzi I:108-213 [98183] Other proteins in same PDB: d1rzia1, d1rzib1, d1rzib2, d1rzic1, d1rzid1, d1rzid2, d1rzie1, d1rzif1, d1rzif2, d1rzig1, d1rzih1, d1rzih2, d1rzii1, d1rzij1, d1rzij2, d1rzik1, d1rzil1, d1rzil2, d1rzim1, d1rzin1, d1rzin2, d1rzio1, d1rzip1, d1rzip2 |
PDB Entry: 1rzi (more details), 2.9 Å
SCOP Domain Sequences for d1rzii2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzii2 b.1.1.2 (I:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d1rzii2:
View in 3D Domains from other chains: (mouse over for more information) d1rzia1, d1rzia2, d1rzib1, d1rzib2, d1rzic1, d1rzic2, d1rzid1, d1rzid2, d1rzie1, d1rzie2, d1rzif1, d1rzif2, d1rzig1, d1rzig2, d1rzih1, d1rzih2, d1rzij1, d1rzij2, d1rzik1, d1rzik2, d1rzil1, d1rzil2, d1rzim1, d1rzim2, d1rzin1, d1rzin2, d1rzio1, d1rzio2, d1rzip1, d1rzip2 |