Lineage for d1rzig2 (1rzi G:108-213)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365640Species Human (Homo sapiens) [TaxId:9606] [88569] (74 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 365740Domain d1rzig2: 1rzi G:108-213 [98179]
    Other proteins in same PDB: d1rzia1, d1rzib1, d1rzib2, d1rzic1, d1rzid1, d1rzid2, d1rzie1, d1rzif1, d1rzif2, d1rzig1, d1rzih1, d1rzih2, d1rzii1, d1rzij1, d1rzij2, d1rzik1, d1rzil1, d1rzil2, d1rzim1, d1rzin1, d1rzin2, d1rzio1, d1rzip1, d1rzip2

Details for d1rzig2

PDB Entry: 1rzi (more details), 2.9 Å

PDB Description: Crystal structure of human anti-HIV-1 gp120-reactive antibody 47e fab

SCOP Domain Sequences for d1rzig2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzig2 b.1.1.2 (G:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOP Domain Coordinates for d1rzig2:

Click to download the PDB-style file with coordinates for d1rzig2.
(The format of our PDB-style files is described here.)

Timeline for d1rzig2: