Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (33 PDB entries) |
Domain d1rzif1: 1rzi F:1-113 [98176] Other proteins in same PDB: d1rzia1, d1rzia2, d1rzib2, d1rzic1, d1rzic2, d1rzid2, d1rzie1, d1rzie2, d1rzif2, d1rzig1, d1rzig2, d1rzih2, d1rzii1, d1rzii2, d1rzij2, d1rzik1, d1rzik2, d1rzil2, d1rzim1, d1rzim2, d1rzin2, d1rzio1, d1rzio2, d1rzip2 |
PDB Entry: 1rzi (more details), 2.9 Å
SCOP Domain Sequences for d1rzif1:
Sequence, based on SEQRES records: (download)
>d1rzif1 b.1.1.1 (F:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg qgttvtvas
>d1rzif1 b.1.1.1 (F:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany aqkfqgrvtitadeatsttymelsslrsedtavyfcakgghgmdvwgqgttvtvas
Timeline for d1rzif1:
View in 3D Domains from other chains: (mouse over for more information) d1rzia1, d1rzia2, d1rzib1, d1rzib2, d1rzic1, d1rzic2, d1rzid1, d1rzid2, d1rzie1, d1rzie2, d1rzig1, d1rzig2, d1rzih1, d1rzih2, d1rzii1, d1rzii2, d1rzij1, d1rzij2, d1rzik1, d1rzik2, d1rzil1, d1rzil2, d1rzim1, d1rzim2, d1rzin1, d1rzin2, d1rzio1, d1rzio2, d1rzip1, d1rzip2 |