Lineage for d1rzif1 (1rzi F:1-113)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 362802Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (16 PDB entries)
  8. 362825Domain d1rzif1: 1rzi F:1-113 [98176]
    Other proteins in same PDB: d1rzia1, d1rzia2, d1rzib2, d1rzic1, d1rzic2, d1rzid2, d1rzie1, d1rzie2, d1rzif2, d1rzig1, d1rzig2, d1rzih2, d1rzii1, d1rzii2, d1rzij2, d1rzik1, d1rzik2, d1rzil2, d1rzim1, d1rzim2, d1rzin2, d1rzio1, d1rzio2, d1rzip2

Details for d1rzif1

PDB Entry: 1rzi (more details), 2.9 Å

PDB Description: Crystal structure of human anti-HIV-1 gp120-reactive antibody 47e fab

SCOP Domain Sequences for d1rzif1:

Sequence, based on SEQRES records: (download)

>d1rzif1 b.1.1.1 (F:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1}
qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
qgttvtvas

Sequence, based on observed residues (ATOM records): (download)

>d1rzif1 b.1.1.1 (F:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1}
qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
aqkfqgrvtitadeatsttymelsslrsedtavyfcakgghgmdvwgqgttvtvas

SCOP Domain Coordinates for d1rzif1:

Click to download the PDB-style file with coordinates for d1rzif1.
(The format of our PDB-style files is described here.)

Timeline for d1rzif1: