Lineage for d1rzid2 (1rzi D:114-213)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1515183Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1515187Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 1515444Domain d1rzid2: 1rzi D:114-213 [98173]
    Other proteins in same PDB: d1rzia1, d1rzia2, d1rzib1, d1rzic1, d1rzic2, d1rzid1, d1rzie1, d1rzie2, d1rzif1, d1rzig1, d1rzig2, d1rzih1, d1rzii1, d1rzii2, d1rzij1, d1rzik1, d1rzik2, d1rzil1, d1rzim1, d1rzim2, d1rzin1, d1rzio1, d1rzio2, d1rzip1
    part of anti HIV-1 gp120-reactive Fab 47E

Details for d1rzid2

PDB Entry: 1rzi (more details), 2.9 Å

PDB Description: Crystal structure of human anti-HIV-1 gp120-reactive antibody 47e fab
PDB Compounds: (D:) Fab 47e heavy chain

SCOPe Domain Sequences for d1rzid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzid2 b.1.1.2 (D:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d1rzid2:

Click to download the PDB-style file with coordinates for d1rzid2.
(The format of our PDB-style files is described here.)

Timeline for d1rzid2: