Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1rzhm_ (1rzh M:)

  1. Root: SCOP 1.75B
  2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 protein domains)
    L and M are probably related to each other
  6. Protein M (medium) subunit [81481] (3 species)
  7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (46 PDB entries)
    Uniprot P02953
  8. Domain d1rzhm_: 1rzh M: [98165]
    Other proteins in same PDB: d1rzhh1, d1rzhh2, d1rzhl_
    complexed with bcl, bph, cdl, fe2, gol, hto, lda, po4, spo, u10; mutant

Details for d1rzhm_

PDB Entry: 1rzh (more details)
PDB Description: photosynthetic reaction center double mutant from rhodobacte sphaeroides with asp l213 replaced with asn and arg m233 re with cys in the charge-neutral dqaqb state (trigonal form)
PDB Compounds: (M:) reaction center protein m chain

SCOP Domain Sequences for d1rzhm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzhm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggeceleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
h

SCOP Domain Coordinates for d1rzhm_:

Click to download the PDB-style file with coordinates for d1rzhm_.
(The format of our PDB-style files is described here.)

Timeline for d1rzhm_:

d1rzhm_ appears in SCOP 1.75A


d1rzhm_
(click for larger image)


d1rzhm_ in context of chain



d1rzhm_ in context of PDB
Domains from other chains:
d1rzhh1, d1rzhh2, d1rzhl_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu