Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1rzhh1 (1rzh H:36-248)

  1. Root: SCOP 1.75B
  2. Class b: All beta proteins [48724] (174 folds)
  3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. Superfamily b.41.1: PRC-barrel domain [50346] (4 families) (S)
  5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. Protein Photosynthetic reaction centre [50348] (3 species)
  7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (39 PDB entries)
    Uniprot P11846
  8. Domain d1rzhh1: 1rzh H:36-248 [98162]
    Other proteins in same PDB: d1rzhh2, d1rzhl_, d1rzhm_
    complexed with bcl, bph, cdl, fe2, gol, hto, lda, po4, spo, u10; mutant

Details for d1rzhh1

PDB Entry: 1rzh (more details)
PDB Description: photosynthetic reaction center double mutant from rhodobacte sphaeroides with asp l213 replaced with asn and arg m233 re with cys in the charge-neutral dqaqb state (trigonal form)
PDB Compounds: (H:) reaction center protein h chain

SCOP Domain Sequences for d1rzhh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzhh1 b.41.1.1 (H:36-248) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkr

SCOP Domain Coordinates for d1rzhh1:

Click to download the PDB-style file with coordinates for d1rzhh1.
(The format of our PDB-style files is described here.)

Timeline for d1rzhh1:

d1rzhh1 appears in SCOP 1.75A


d1rzhh1
(click for larger image)


d1rzhh1 in context of chain
Domains from same chain:
d1rzhh2


d1rzhh1 in context of PDB
Domains from other chains:
d1rzhl_, d1rzhm_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu