Lineage for d1rzgc1 (1rzg C:2-113)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1287745Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)
  8. 1287754Domain d1rzgc1: 1rzg C:2-113 [98158]
    Other proteins in same PDB: d1rzga2, d1rzgb1, d1rzgb2, d1rzgc2, d1rzgd1, d1rzgd2
    part of anti HIV-1 gp120-reactive Fab 412D
    complexed with cys, suc

Details for d1rzgc1

PDB Entry: 1rzg (more details), 2 Å

PDB Description: crystal structure of human anti-hiv-1 gp120 reactive antibody 412d
PDB Compounds: (C:) Fab 412d light chain

SCOPe Domain Sequences for d1rzgc1:

Sequence, based on SEQRES records: (download)

>d1rzgc1 b.1.1.1 (C:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
vqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahya
qrfqgrvsitadeststaymelsslrsedtavfycaspypndyndyapeegmswyfdlwg
rgtlvtvsp

Sequence, based on observed residues (ATOM records): (download)

>d1rzgc1 b.1.1.1 (C:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
vqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahya
qrfqgrvsitadeststaymelsslrsedtavfycaspypndygmswyfdlwgrgtlvtv
sp

SCOPe Domain Coordinates for d1rzgc1:

Click to download the PDB-style file with coordinates for d1rzgc1.
(The format of our PDB-style files is described here.)

Timeline for d1rzgc1: