SCOP 1.75: Domain d1rzgc1: 1rzg C:2-113

Lineage for d1rzgc1 (1rzg C:2-113)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (36 PDB entries)

8. Domain d1rzgc1: 1rzg C:2-113 [98158]
   Other proteins in same PDB: d1rzga2, d1rzgb1, d1rzgb2, d1rzgc2, d1rzgd1, d1rzgd2
   part of anti HIV-1 gp120-reactive Fab 412D
   complexed with suc

Details for d1rzgc1

PDB Entry: 1rzg, 2 Å

PDB Description: crystal structure of human anti-hiv-1 gp120 reactive antibody 412d

PDB Compounds: (C:) Fab 412d light chain

SCOP Domain Sequences for d1rzgc1:

Sequence, based on SEQRES records:

>d1rzgc1 b.1.1.1 (C:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
vqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahya
qrfqgrvsitadeststaymelsslrsedtavfycaspypndyndyapeegmswyfdlwg
rgtlvtvsp

Sequence, based on observed residues (ATOM records):

>d1rzgc1 b.1.1.1 (C:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
vqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahya
qrfqgrvsitadeststaymelsslrsedtavfycaspypndygmswyfdlwgrgtlvtv
sp

Timeline for d1rzgc1:

• d1rzgc1 first appeared in SCOP 1.67
  
• d1rzgc1 appears in SCOP 1.73
  
• d1rzgc1 appears in SCOPe 2.01
  
• d1rzgc1 appears in the current release, SCOPe 2.08