Lineage for d1rzga1 (1rzg A:1-113)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 546633Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (15 PDB entries)
  8. 546638Domain d1rzga1: 1rzg A:1-113 [98154]
    Other proteins in same PDB: d1rzga2, d1rzgb1, d1rzgb2, d1rzgc2, d1rzgd1, d1rzgd2

Details for d1rzga1

PDB Entry: 1rzg (more details), 2 Å

PDB Description: Crystal structure of Human anti-HIV-1 GP120 reactive antibody 412d

SCOP Domain Sequences for d1rzga1:

Sequence, based on SEQRES records: (download)

>d1rzga1 b.1.1.1 (A:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1}
evqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahy
aqrfqgrvsitadeststaymelsslrsedtavfycaspypndyndyapeegmswyfdlw
grgtlvtvsp

Sequence, based on observed residues (ATOM records): (download)

>d1rzga1 b.1.1.1 (A:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1}
evqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahy
aqrfqgrvsitadeststaymelsslrsedtavfycaspypndygmswyfdlwgrgtlvt
vsp

SCOP Domain Coordinates for d1rzga1:

Click to download the PDB-style file with coordinates for d1rzga1.
(The format of our PDB-style files is described here.)

Timeline for d1rzga1: