Lineage for d1rzfl2 (1rzf L:109-210)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293989Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 1293993Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)
  8. 1293995Domain d1rzfl2: 1rzf L:109-210 [98153]
    Other proteins in same PDB: d1rzfh1, d1rzfh2, d1rzfl1
    part of anti HIV-1 gp120-reactive Fab E51
    complexed with gol, ipa

Details for d1rzfl2

PDB Entry: 1rzf (more details), 1.7 Å

PDB Description: Crystal structure of Human anti-HIV-1 GP120-reactive antibody E51
PDB Compounds: (L:) Fab E51 light chain

SCOPe Domain Sequences for d1rzfl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d1rzfl2:

Click to download the PDB-style file with coordinates for d1rzfl2.
(The format of our PDB-style files is described here.)

Timeline for d1rzfl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rzfl1