Lineage for d1rz9c_ (1rz9 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963164Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2963165Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2963212Family d.89.1.3: Replication protein Rep, nuclease domain [75492] (2 proteins)
    automatically mapped to Pfam PF08724
  6. 2963213Protein Replication protein Rep, nuclease domain [75493] (1 species)
  7. 2963214Species Adeno-associated virus, aav-5 [TaxId:272636] [75494] (3 PDB entries)
  8. 2963221Domain d1rz9c_: 1rz9 C: [98147]
    protein/DNA complex

Details for d1rz9c_

PDB Entry: 1rz9 (more details), 3.1 Å

PDB Description: Crystal Structure of AAV Rep complexed with the Rep-binding sequence
PDB Compounds: (C:) Rep protein

SCOPe Domain Sequences for d1rz9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rz9c_ d.89.1.3 (C:) Replication protein Rep, nuclease domain {Adeno-associated virus, aav-5 [TaxId: 272636]}
matfyevivrvpfdveehlpgisdsfvdwvtgqiwelppesdlnltlveqpqltvadrir
rvflyewnkfskqeskffvqfekgseyfhlhtlvetsgissmvlgryvsqiraqlvkvvf
qgiepqindwvaitkvkkggankvvdsgyipayllpkvqpelqwawtnldeyklaalnle
erkrlvaqflaes

SCOPe Domain Coordinates for d1rz9c_:

Click to download the PDB-style file with coordinates for d1rz9c_.
(The format of our PDB-style files is described here.)

Timeline for d1rz9c_: