Lineage for d1rz9b_ (1rz9 B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415324Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 415325Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (5 families) (S)
  5. 415349Family d.89.1.3: Replication protein Rep, nuclease domain [75492] (1 protein)
  6. 415350Protein Replication protein Rep, nuclease domain [75493] (1 species)
  7. 415351Species Adeno-associated virus, aav-5 [TaxId:272636] [75494] (3 PDB entries)
  8. 415357Domain d1rz9b_: 1rz9 B: [98146]

Details for d1rz9b_

PDB Entry: 1rz9 (more details), 3.1 Å

PDB Description: Crystal Structure of AAV Rep complexed with the Rep-binding sequence

SCOP Domain Sequences for d1rz9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rz9b_ d.89.1.3 (B:) Replication protein Rep, nuclease domain {Adeno-associated virus, aav-5}
matfyevivrvpfdveehlpgisdsfvdwvtgqiwelppesdlnltlveqpqltvadrir
rvflyewnkfskqeskffvqfekgseyfhlhtlvetsgissmvlgryvsqiraqlvkvvf
qgiepqindwvaitkvkkggankvvdsgyipayllpkvqpelqwawtnldeyklaalnle
erkrlvaqflaes

SCOP Domain Coordinates for d1rz9b_:

Click to download the PDB-style file with coordinates for d1rz9b_.
(The format of our PDB-style files is described here.)

Timeline for d1rz9b_: