![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily) alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325 |
![]() | Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (5 families) ![]() |
![]() | Family d.89.1.3: Replication protein Rep, nuclease domain [75492] (1 protein) |
![]() | Protein Replication protein Rep, nuclease domain [75493] (1 species) |
![]() | Species Adeno-associated virus, aav-5 [TaxId:272636] [75494] (3 PDB entries) |
![]() | Domain d1rz9b_: 1rz9 B: [98146] |
PDB Entry: 1rz9 (more details), 3.1 Å
SCOP Domain Sequences for d1rz9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rz9b_ d.89.1.3 (B:) Replication protein Rep, nuclease domain {Adeno-associated virus, aav-5} matfyevivrvpfdveehlpgisdsfvdwvtgqiwelppesdlnltlveqpqltvadrir rvflyewnkfskqeskffvqfekgseyfhlhtlvetsgissmvlgryvsqiraqlvkvvf qgiepqindwvaitkvkkggankvvdsgyipayllpkvqpelqwawtnldeyklaalnle erkrlvaqflaes
Timeline for d1rz9b_:
![]() Domains from other chains: (mouse over for more information) d1rz9a_, d1rz9c_, d1rz9d_, d1rz9e_ |