Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily) alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325 |
Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) |
Family d.89.1.3: Replication protein Rep, nuclease domain [75492] (2 proteins) automatically mapped to Pfam PF08724 |
Protein Replication protein Rep, nuclease domain [75493] (1 species) |
Species Adeno-associated virus, aav-5 [TaxId:272636] [75494] (3 PDB entries) |
Domain d1rz9a_: 1rz9 A: [98145] protein/DNA complex |
PDB Entry: 1rz9 (more details), 3.1 Å
SCOPe Domain Sequences for d1rz9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rz9a_ d.89.1.3 (A:) Replication protein Rep, nuclease domain {Adeno-associated virus, aav-5 [TaxId: 272636]} matfyevivrvpfdveehlpgisdsfvdwvtgqiwelppesdlnltlveqpqltvadrir rvflyewnkfskqeskffvqfekgseyfhlhtlvetsgissmvlgryvsqiraqlvkvvf qgiepqindwvaitkvkkggankvvdsgyipayllpkvqpelqwawtnldeyklaalnle erkrlvaqflaes
Timeline for d1rz9a_:
View in 3D Domains from other chains: (mouse over for more information) d1rz9b_, d1rz9c_, d1rz9d_, d1rz9e_ |