SCOP 1.73: Domain d1rz8d1: 1rz8 D:1-113

Lineage for d1rz8d1 (1rz8 D:1-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (33 PDB entries)

8. Domain d1rz8d1: 1rz8 D:1-113 [98143]
   Other proteins in same PDB: d1rz8a1, d1rz8a2, d1rz8b2, d1rz8c1, d1rz8c2, d1rz8d2
   part of anti HIV-1 gp120-reactive Fab 17B

Details for d1rz8d1

PDB Entry: 1rz8, 2.3 Å

PDB Description: crystal structure of human anti-hiv-1 gp120-reactive antibody 17b

PDB Compounds: (D:) Fab 17b heavy chain

SCOP Domain Sequences for d1rz8d1:

Sequence; same for both SEQRES and ATOM records:

>d1rz8d1 b.1.1.1 (D:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
evqlvesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgq
gtlvtvss

Timeline for d1rz8d1:

• d1rz8d1 first appeared in SCOP 1.67
  
• d1rz8d1 appears in SCOP 1.71
  
• d1rz8d1 appears in SCOP 1.75
  
• d1rz8d1 appears in the current release, SCOPe 2.08