SCOPe 2.03: Domain d1rz8c2: 1rz8 C:110-212

Lineage for d1rz8c2 (1rz8 C:110-212)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

Domain d1rz8c2: 1rz8 C:110-212 [98142]
Other proteins in same PDB: d1rz8a1, d1rz8b1, d1rz8b2, d1rz8c1, d1rz8d1, d1rz8d2
part of anti HIV-1 gp120-reactive Fab 17B

Details for d1rz8c2

PDB Entry: 1rz8 (more details), 2.3 Å

PDB Description: crystal structure of human anti-hiv-1 gp120-reactive antibody 17b

PDB Compounds: (C:) Fab 17b light chain

SCOPe Domain Sequences for d1rz8c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rz8c2 b.1.1.2 (C:110-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
vaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d1rz8c2:

Click to download the PDB-style file with coordinates for d1rz8c2.
(The format of our PDB-style files is described here.)

Timeline for d1rz8c2: