Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (78 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1rz8c2: 1rz8 C:110-212 [98142] Other proteins in same PDB: d1rz8a1, d1rz8b1, d1rz8b2, d1rz8c1, d1rz8d1, d1rz8d2 part of anti HIV-1 gp120-reactive Fab 17B |
PDB Entry: 1rz8 (more details), 2.3 Å
SCOP Domain Sequences for d1rz8c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rz8c2 b.1.1.2 (C:110-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)} vaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk dstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d1rz8c2: